(data stored in ACNUC7421 zone)

EMBL: CP001389.PE522

CP001389.PE522       Location/Qualifiers
FT   CDS             585621..586004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24326"
FT                   /db_xref="GOA:C3MHJ8"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ8"
FT                   /protein_id="ACP24326.1"
FT                   /translation="MNDDKALYPPVDPIVAGIKGLCPRCGQGHVFDGFLKVRPACENCE
FT                   LDYRFADSGDGPVVFVILIVGFIVVGAALWMEVNLNPPLWLHFLLWIPLATVFSLVLTR
FT                   MLKGVLINLQYRNNARSGEIDRG"
     MNDDKALYPP VDPIVAGIKG LCPRCGQGHV FDGFLKVRPA CENCELDYRF ADSGDGPVVF        60
     VILIVGFIVV GAALWMEVNL NPPLWLHFLL WIPLATVFSL VLTRMLKGVL INLQYRNNAR       120
     SGEIDRG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page