(data stored in ACNUC7421 zone)

EMBL: CP001389.PE523

CP001389.PE523       Location/Qualifiers
FT   CDS             585973..586758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24327"
FT                   /db_xref="GOA:C3MHJ9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ9"
FT                   /protein_id="ACP24327.1"
FT                   /translation="MRVRAKLTVAEAHRSTSRGHFGPIAGLVLVAITFVVLIALGTWQV
FT                   ERLQWKEALIAAIAERRSAPPVSVEEIEAMAAAGEDVDYRTTRVSGVYDHDKERHFFAT
FT                   HEGRTGYYVFTPLMLADGRALFVNRGFVPFERKDAATRPEGEVTGNVTIDGLARPRLSE
FT                   KPSSLVPDNDLAKNIFYWKDLDAMASTAGIAADRVLPFFVDADASKNPGGLPIGGVTQF
FT                   DLPNNHLQYALTWYGLAAALVVVSGAYLYRQGRKDVSKN"
     MRVRAKLTVA EAHRSTSRGH FGPIAGLVLV AITFVVLIAL GTWQVERLQW KEALIAAIAE        60
     RRSAPPVSVE EIEAMAAAGE DVDYRTTRVS GVYDHDKERH FFATHEGRTG YYVFTPLMLA       120
     DGRALFVNRG FVPFERKDAA TRPEGEVTGN VTIDGLARPR LSEKPSSLVP DNDLAKNIFY       180
     WKDLDAMAST AGIAADRVLP FFVDADASKN PGGLPIGGVT QFDLPNNHLQ YALTWYGLAA       240
     ALVVVSGAYL YRQGRKDVSK N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page