(data stored in ACNUC7421 zone)

EMBL: CP001389.PE524

CP001389.PE524       Location/Qualifiers
FT   CDS             586771..587136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24328"
FT                   /db_xref="GOA:C3MHK0"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK0"
FT                   /protein_id="ACP24328.1"
FT                   /translation="MGILAAILIVLTALLHVGFLVLEMFLWTKPQGRAVFRMTAERAET
FT                   TWVLAANQGLYNGFLAAGLLWSLIQPEPAFALQLKVFFLVCVIVAAIYGAWSVKPRILL
FT                   VQGGPAMLALLFVLLAS"
     MGILAAILIV LTALLHVGFL VLEMFLWTKP QGRAVFRMTA ERAETTWVLA ANQGLYNGFL        60
     AAGLLWSLIQ PEPAFALQLK VFFLVCVIVA AIYGAWSVKP RILLVQGGPA MLALLFVLLA       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page