(data stored in ACNUC7421 zone)

EMBL: CP001389.PE528

CP001389.PE528       Location/Qualifiers
FT   CDS             590015..590965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05360"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-21a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24332"
FT                   /db_xref="GOA:C3MHK4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK4"
FT                   /protein_id="ACP24332.1"
FT                   /translation="MSNISMICAGIDVAKDRLEVAVHPGGARLDVGNDAAGLQALDAFL
FT                   DTHGVQRVGFEASGGYEWRLMAHLRQGPRPAARLQPAQVRAFAKSRLQRAKNDRLDARL
FT                   IAAFTAALERLPELPEARFDNLAAELTYLEQIEQQIALVKTFAEAALTDSIRRRHQRQI
FT                   ETLTKKREAEIERIAKAMRADAQLSRRLDLLVSIKGIGLRSALALVIRLPELGQASREE
FT                   VAALVGVAPFDDDTGKRCGIRHIDGGRERLRKAVFMCAFTAARHNPDLAAFYKRLRQKG
FT                   KDHKLAVIAVARKLVVLANAVVARGSEWTPRYQHP"
     MSNISMICAG IDVAKDRLEV AVHPGGARLD VGNDAAGLQA LDAFLDTHGV QRVGFEASGG        60
     YEWRLMAHLR QGPRPAARLQ PAQVRAFAKS RLQRAKNDRL DARLIAAFTA ALERLPELPE       120
     ARFDNLAAEL TYLEQIEQQI ALVKTFAEAA LTDSIRRRHQ RQIETLTKKR EAEIERIAKA       180
     MRADAQLSRR LDLLVSIKGI GLRSALALVI RLPELGQASR EEVAALVGVA PFDDDTGKRC       240
     GIRHIDGGRE RLRKAVFMCA FTAARHNPDL AAFYKRLRQK GKDHKLAVIA VARKLVVLAN       300
     AVVARGSEWT PRYQHP                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page