(data stored in ACNUC7421 zone)

EMBL: CP001389.PE529

CP001389.PE529       Location/Qualifiers
FT   CDS             complement(591088..591573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05370"
FT                   /product="peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24333"
FT                   /db_xref="GOA:C3MHK5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK5"
FT                   /protein_id="ACP24333.1"
FT                   /translation="MTIAVGDKLPNATFKEKTADGPVEVTTDQLFKGKRVVLFAVPGAF
FT                   TPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVMGAWATSSGGMGKIHFLSDWNA
FT                   AFTKALGLDIDLSAGTLGIRSKRYSMLVEDGVVKALNVEDAPGQATVSGAAAMLEQL"
     MTIAVGDKLP NATFKEKTAD GPVEVTTDQL FKGKRVVLFA VPGAFTPTCS LNHLPGYLEN        60
     RDAILARGVD DIAVVAVNDL HVMGAWATSS GGMGKIHFLS DWNAAFTKAL GLDIDLSAGT       120
     LGIRSKRYSM LVEDGVVKAL NVEDAPGQAT VSGAAAMLEQ L                           161
//

If you have problems or comments...

PBIL Back to PBIL home page