(data stored in ACNUC7421 zone)

EMBL: CP001389.PE53

CP001389.PE53        Location/Qualifiers
FT   CDS             complement(55146..57521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00530"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23857"
FT                   /db_xref="GOA:C3MF20"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF20"
FT                   /protein_id="ACP23857.1"
FT                   /translation="MREDFMFNFHAKSLATKLIAVTGGTIALVLLASNFVLISQTQDRV
FT                   ETLVFDGAKTEARAIAADIAGSVGELAAAARTMSGVLGRGHAGKSTDRAGAINLLKANL
FT                   DQHDFAFGSWFAEEPKAFDGRDVVNNTELGGNAEGAFTPYWSKDRNGKAKLSTFRADYA
FT                   AEWYSLAAKSGKGAITQPYLAEGTDVPTTMTSIAYPVMSDGKMIGVSGADISLASLADR
FT                   LATLKPFGSGRVYLLSQGGKWLAAPIPDLLMKDYEGEGADVIKNALSSDASGMIKNLTY
FT                   DGNEPFDRVVYPFKLPDVNASWVILVDVPRTAINAPVNDQTYMMIIGGIVVLGAVLAGL
FT                   YLAVRRFVQKPLAGLVHDVETLSNGDYARPISGQDRLDETGSVAKALEGFRHQLADTKR
FT                   LEGEARHEREQAERERSRSESERAETGALQRDIVARLGKGLSHLASGDLAYRIADEFPG
FT                   EYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTGEISSAANDLSHRTEQQAASLEETA
FT                   AALDELTSQVDASAENAKVAAKSVELASSDAAQSGEVVQKAIAAMQGIEQSSNEVSRII
FT                   GVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIKTLINTS
FT                   AGQVREGVDLVGKTGGALKKIAEQVVQINGLIRQISGSASEQAVGLKEINAAVNQMDQV
FT                   TQQNAAMVEETTAASMTLNEEARTLSGLVARFSVAKREPAQSSADMLRSAASRMRTAEA
FT                   PRPAPEQPAARGYSTPTQRVLAQTAGGNALARDNWEEF"
     MREDFMFNFH AKSLATKLIA VTGGTIALVL LASNFVLISQ TQDRVETLVF DGAKTEARAI        60
     AADIAGSVGE LAAAARTMSG VLGRGHAGKS TDRAGAINLL KANLDQHDFA FGSWFAEEPK       120
     AFDGRDVVNN TELGGNAEGA FTPYWSKDRN GKAKLSTFRA DYAAEWYSLA AKSGKGAITQ       180
     PYLAEGTDVP TTMTSIAYPV MSDGKMIGVS GADISLASLA DRLATLKPFG SGRVYLLSQG       240
     GKWLAAPIPD LLMKDYEGEG ADVIKNALSS DASGMIKNLT YDGNEPFDRV VYPFKLPDVN       300
     ASWVILVDVP RTAINAPVND QTYMMIIGGI VVLGAVLAGL YLAVRRFVQK PLAGLVHDVE       360
     TLSNGDYARP ISGQDRLDET GSVAKALEGF RHQLADTKRL EGEARHEREQ AERERSRSES       420
     ERAETGALQR DIVARLGKGL SHLASGDLAY RIADEFPGEY AQLKRDFNAT MESLEETIRT       480
     VNHSVVNIGS GTGEISSAAN DLSHRTEQQA ASLEETAAAL DELTSQVDAS AENAKVAAKS       540
     VELASSDAAQ SGEVVQKAIA AMQGIEQSSN EVSRIIGVID EIAFQTNLLA LNAGVEAARA       600
     GEAGKGFAVV AQEVRELAQR SANAAKEIKT LINTSAGQVR EGVDLVGKTG GALKKIAEQV       660
     VQINGLIRQI SGSASEQAVG LKEINAAVNQ MDQVTQQNAA MVEETTAASM TLNEEARTLS       720
     GLVARFSVAK REPAQSSADM LRSAASRMRT AEAPRPAPEQ PAARGYSTPT QRVLAQTAGG       780
     NALARDNWEE F                                                            791
//

If you have problems or comments...

PBIL Back to PBIL home page