(data stored in ACNUC7421 zone)

EMBL: CP001389.PE530

CP001389.PE530       Location/Qualifiers
FT   CDS             complement(591645..592460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24334"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK6"
FT                   /protein_id="ACP24334.1"
FT                   /translation="MAQGLAKASLLAAIFLPMPSQAASSAWVTSPGGAIRLVASQPRPD
FT                   GSIPAIVEIKLEPGWKTYWRDPGASGIPPQVTFDPSGGVALEAIRFPAPKTFGEGPGRY
FT                   VGYDSSVAFPLVLRRVSDEKDLAVRATVFLGVCEDICIPVQGTLDLTLKGGEFDNPLDG
FT                   ARIEKAVASLPEPPSDDFRIMKAAFDAAGGVIHLDLRLPRDAGKPEIFLAGPAGFAFGA
FT                   PVVGDAAGAERRVDIPLKLSGKDRKVAGKPIALTVRAGDRSMETTLAFD"
     MAQGLAKASL LAAIFLPMPS QAASSAWVTS PGGAIRLVAS QPRPDGSIPA IVEIKLEPGW        60
     KTYWRDPGAS GIPPQVTFDP SGGVALEAIR FPAPKTFGEG PGRYVGYDSS VAFPLVLRRV       120
     SDEKDLAVRA TVFLGVCEDI CIPVQGTLDL TLKGGEFDNP LDGARIEKAV ASLPEPPSDD       180
     FRIMKAAFDA AGGVIHLDLR LPRDAGKPEI FLAGPAGFAF GAPVVGDAAG AERRVDIPLK       240
     LSGKDRKVAG KPIALTVRAG DRSMETTLAF D                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page