(data stored in ACNUC7421 zone)

EMBL: CP001389.PE531

CP001389.PE531       Location/Qualifiers
FT   CDS             592735..593340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24335"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK7"
FT                   /protein_id="ACP24335.1"
FT                   /translation="MATAVQQKIRERGFLDGQFLIAMPSMFDANFARTVIFVCAHSEDG
FT                   AMGFVLNRPQRLTFPDVLLHLQLLDPDEVIRLPSAAREFQIQAGGPVETGRGFVLHSDD
FT                   YLSDSSIPVSDDICLTATLDIVKAISRGEGPLKATMLLGYAGWGPGQLENEISSNGWLT
FT                   CPAREELIFSRDLDEKYDRALALMGISPAMLSSDAGHA"
     MATAVQQKIR ERGFLDGQFL IAMPSMFDAN FARTVIFVCA HSEDGAMGFV LNRPQRLTFP        60
     DVLLHLQLLD PDEVIRLPSA AREFQIQAGG PVETGRGFVL HSDDYLSDSS IPVSDDICLT       120
     ATLDIVKAIS RGEGPLKATM LLGYAGWGPG QLENEISSNG WLTCPAREEL IFSRDLDEKY       180
     DRALALMGIS PAMLSSDAGH A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page