(data stored in ACNUC7421 zone)

EMBL: CP001389.PE532

CP001389.PE532       Location/Qualifiers
FT   CDS             complement(593365..596280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05400"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24336"
FT                   /db_xref="GOA:C3MHK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK8"
FT                   /protein_id="ACP24336.1"
FT                   /translation="MMPLTRKPFASSTARLAAFLVAFAVFIFGVAGGVAHALEPVKISR
FT                   EDTALDLTATTEIYSGRGEAFQVSTAPGTDGIVRRIEVRSSTEHHQGDWAVFALANVSE
FT                   EQLERVIVAPHFRLVNSKLFWPDLGSQRILSITPSEGFALDRQPSDEADVFRITLNPGA
FT                   VITFVAELATPELPQIYLWQPDAYKDTVNAFTLYRGIVLGIAGLLAVFLTILFVVKGTS
FT                   MLPATAALAWAVLAYICVDFGFLSKLISVTAGDERIWRAGTEVFLAAGLVIFLFTYLNL
FT                   NRWHQHLGYATLAWILGLALLFGVAVYDPAIASGIARLSFALTATVGIVLIAYLGFNRY
FT                   DRAILLVPAWLLILVWLFGAWLAVTGQLANDIVQPALGGGLVLIVLLIGFTVMQHAFAG
FT                   GAYQQGLFSDLERQALALTGSGDTVWDWDVARDRVVTIPDISHQLGLSLGTMNGPVRNW
FT                   VPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRARAEDGHYHWLSIRARPVLGANGEIIR
FT                   CVGTIVDITEQRNSVERLLQNALLDNLTGLPNRQVFLDRLQAILLMSDGTNAVRPTVLA
FT                   IDIDRYKQVNDLLGIAAGDNILIALTRRLRRLLRPQDTLARLGGDQFGLILMSERDPAK
FT                   IADFADAVSKAIMVPLNYGNREINLTASIGLVSWLDQEQSAASLLDDAELAMFRAKKEG
FT                   GNRVEPFRPAFRTSGSDRLQLEADLKRAIERKELSLVYQPIVRLSDAEVAGFEALMRWD
FT                   HPKRGNVSPTEFIPIAENSDIINQLGMFAFDQATSDLSEWQIQTGDLPIFVSINLSSAQ
FT                   LLNSGLYDDVRAILNKNRCDPAKVKMELTESLVMENPEQARLVLEKLREAGLRLALDDF
FT                   GTGHSSLSYLTRFPFDTIKIDKALVRDPSDKRGVVLRSVIAMARELDMRVVAEGIESEE
FT                   DAIQLAQMGCDYGQSFLFGPPVGSESILRLLKERFPLMKRA"
     MMPLTRKPFA SSTARLAAFL VAFAVFIFGV AGGVAHALEP VKISREDTAL DLTATTEIYS        60
     GRGEAFQVST APGTDGIVRR IEVRSSTEHH QGDWAVFALA NVSEEQLERV IVAPHFRLVN       120
     SKLFWPDLGS QRILSITPSE GFALDRQPSD EADVFRITLN PGAVITFVAE LATPELPQIY       180
     LWQPDAYKDT VNAFTLYRGI VLGIAGLLAV FLTILFVVKG TSMLPATAAL AWAVLAYICV       240
     DFGFLSKLIS VTAGDERIWR AGTEVFLAAG LVIFLFTYLN LNRWHQHLGY ATLAWILGLA       300
     LLFGVAVYDP AIASGIARLS FALTATVGIV LIAYLGFNRY DRAILLVPAW LLILVWLFGA       360
     WLAVTGQLAN DIVQPALGGG LVLIVLLIGF TVMQHAFAGG AYQQGLFSDL ERQALALTGS       420
     GDTVWDWDVA RDRVVTIPDI SHQLGLSLGT MNGPVRNWVP RLHPDDRDRF RATLDVLLEH       480
     RRGRLNHEFR ARAEDGHYHW LSIRARPVLG ANGEIIRCVG TIVDITEQRN SVERLLQNAL       540
     LDNLTGLPNR QVFLDRLQAI LLMSDGTNAV RPTVLAIDID RYKQVNDLLG IAAGDNILIA       600
     LTRRLRRLLR PQDTLARLGG DQFGLILMSE RDPAKIADFA DAVSKAIMVP LNYGNREINL       660
     TASIGLVSWL DQEQSAASLL DDAELAMFRA KKEGGNRVEP FRPAFRTSGS DRLQLEADLK       720
     RAIERKELSL VYQPIVRLSD AEVAGFEALM RWDHPKRGNV SPTEFIPIAE NSDIINQLGM       780
     FAFDQATSDL SEWQIQTGDL PIFVSINLSS AQLLNSGLYD DVRAILNKNR CDPAKVKMEL       840
     TESLVMENPE QARLVLEKLR EAGLRLALDD FGTGHSSLSY LTRFPFDTIK IDKALVRDPS       900
     DKRGVVLRSV IAMARELDMR VVAEGIESEE DAIQLAQMGC DYGQSFLFGP PVGSESILRL       960
     LKERFPLMKR A                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page