(data stored in ACNUC7421 zone)

EMBL: CP001389.PE534

CP001389.PE534       Location/Qualifiers
FT   CDS             complement(597154..598452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05420"
FT                   /product="peptidase, family M16 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24338"
FT                   /db_xref="GOA:C3MHL0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL0"
FT                   /protein_id="ACP24338.1"
FT                   /translation="MMKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVDEHG
FT                   IAHLLEHMAFKGTRRRSARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAIDIL
FT                   ADILTESTFDEEELRREKHVILQEIGAADDTPDDVVFDRFAETAYRDQTVGRPILGTPE
FT                   TVMSFTPGQIRQYLGRNYTTDRMFIVAAGAVDHDSIVRQVQERFSSLPVAPLSPPVLDT
FT                   ARYTGGDSRESRDLMDAQVLLGFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHR
FT                   GLCYSVYAFHWGFSDTGIFGIHAATGGENLPELMPVIIDELRKSSTSIDQQEIERARAQ
FT                   IRAQLLMGQESPAARAGQIARQMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTA
FT                   PTLSAIGPLDQLAPMSDILSSLNTKSAVHALAG"
     MMKVECTRLP SGLTVVTERM PHLESVALGV WIKSGSRNET VDEHGIAHLL EHMAFKGTRR        60
     RSARQIAEEI ENVGGEVNAA TSTETTSYYA RVLKDHVPLA IDILADILTE STFDEEELRR       120
     EKHVILQEIG AADDTPDDVV FDRFAETAYR DQTVGRPILG TPETVMSFTP GQIRQYLGRN       180
     YTTDRMFIVA AGAVDHDSIV RQVQERFSSL PVAPLSPPVL DTARYTGGDS RESRDLMDAQ       240
     VLLGFEGRAY HARDFYCSQI LANILGGGMS SRLFQEVREH RGLCYSVYAF HWGFSDTGIF       300
     GIHAATGGEN LPELMPVIID ELRKSSTSID QQEIERARAQ IRAQLLMGQE SPAARAGQIA       360
     RQMMLYGRPI PNEELMERLS GITIERLTDL AGRLFFDTAP TLSAIGPLDQ LAPMSDILSS       420
     LNTKSAVHAL AG                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page