(data stored in ACNUC7421 zone)

EMBL: CP001389.PE537

CP001389.PE537       Location/Qualifiers
FT   CDS             complement(600926..602032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05450"
FT                   /product="amino acid ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24341"
FT                   /db_xref="GOA:C3MHL3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL3"
FT                   /protein_id="ACP24341.1"
FT                   /translation="MRLSLLTGMTLAAGMAFAPLAHADITLGVITPLTGPVAAFGEQVK
FT                   NGAEAAVEAINDAGGIKGEKLVLKIVDDAGEPKQSVSVSNQLAGEGVRYVVGPVLSGTA
FT                   MPASDVLAENGILMVTPTATTPDLTTRGLWNVLRTCGRDDQQAVVAADYVVKNLKDKRV
FT                   AVLHDKGAYGKGLADGFKAAINAGGITEVVYEGLNPGEKDFSAIVTRLKAENVDVVYFG
FT                   GYHAEAGLMIRQMRDQGVNAQLIGGDGLSNTEFWAIGADAAEGTIFTNASDATRNPAAA
FT                   PVIEALKAKNIPAEAFTLNAYAAVQVIKAGIEMAGSAEDATAVATAIKSGEEIDTVIGK
FT                   LTFGESGDLTSPSFSLYKWEAGKSVAAE"
     MRLSLLTGMT LAAGMAFAPL AHADITLGVI TPLTGPVAAF GEQVKNGAEA AVEAINDAGG        60
     IKGEKLVLKI VDDAGEPKQS VSVSNQLAGE GVRYVVGPVL SGTAMPASDV LAENGILMVT       120
     PTATTPDLTT RGLWNVLRTC GRDDQQAVVA ADYVVKNLKD KRVAVLHDKG AYGKGLADGF       180
     KAAINAGGIT EVVYEGLNPG EKDFSAIVTR LKAENVDVVY FGGYHAEAGL MIRQMRDQGV       240
     NAQLIGGDGL SNTEFWAIGA DAAEGTIFTN ASDATRNPAA APVIEALKAK NIPAEAFTLN       300
     AYAAVQVIKA GIEMAGSAED ATAVATAIKS GEEIDTVIGK LTFGESGDLT SPSFSLYKWE       360
     AGKSVAAE                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page