(data stored in ACNUC7421 zone)

EMBL: CP001389.PE538

CP001389.PE538       Location/Qualifiers
FT   CDS             complement(602415..603110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24342"
FT                   /db_xref="GOA:C3MHL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL4"
FT                   /protein_id="ACP24342.1"
FT                   /translation="MTGIDLIIFDCDGVLVDSEIIASEVQAELVSEAGFPISVEEMNER
FT                   FAGLTWRDTLLTIEREASIPLSASLIDRVDTILDKRLARDVKIIDGVKPVLLQLTLPHC
FT                   ICSNSTSARLATMLGKVGIKDHFGKHIYSARDLGPDRVKPKPDIFLHGAAQFGVDPARV
FT                   LVIEDSVHGVHGARAAGMRVVGFTGGSHTYPSHADKLTDAGAETVVSRMAALPGVIAAL
FT                   AEWSESLTA"
     MTGIDLIIFD CDGVLVDSEI IASEVQAELV SEAGFPISVE EMNERFAGLT WRDTLLTIER        60
     EASIPLSASL IDRVDTILDK RLARDVKIID GVKPVLLQLT LPHCICSNST SARLATMLGK       120
     VGIKDHFGKH IYSARDLGPD RVKPKPDIFL HGAAQFGVDP ARVLVIEDSV HGVHGARAAG       180
     MRVVGFTGGS HTYPSHADKL TDAGAETVVS RMAALPGVIA ALAEWSESLT A                231
//

If you have problems or comments...

PBIL Back to PBIL home page