(data stored in ACNUC7421 zone)

EMBL: CP001389.PE540

CP001389.PE540       Location/Qualifiers
FT   CDS             604003..604422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24344"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL6"
FT                   /protein_id="ACP24344.1"
FT                   /translation="MVRLRGHHLLCLLTFVGEGYTPAFTGNFRLIAARLSNGEAIEIVE
FT                   GPDDICVPMLDRPEAHCRNTDIRDRDAWALAAIGERLGIALKAGSILNLDGQRLDALRA
FT                   AFAAGLIRAACHECEWSGFCTRIARDGFEGTLVQS"
     MVRLRGHHLL CLLTFVGEGY TPAFTGNFRL IAARLSNGEA IEIVEGPDDI CVPMLDRPEA        60
     HCRNTDIRDR DAWALAAIGE RLGIALKAGS ILNLDGQRLD ALRAAFAAGL IRAACHECEW       120
     SGFCTRIARD GFEGTLVQS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page