(data stored in ACNUC7421 zone)

EMBL: CP001389.PE543

CP001389.PE543       Location/Qualifiers
FT   CDS             605653..606009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24347"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL9"
FT                   /protein_id="ACP24347.1"
FT                   /translation="MIAVIFEVLPSEGERATYLGLAADLRPLLDRIDGFISIERFQSLA
FT                   DPNKLLSLSFWRDEEAVKAWRNGAEHRAAQGAGRNGVFADYRLRIAAVVRDYGLNHRDE
FT                   APADSRQWHEGNAA"
     MIAVIFEVLP SEGERATYLG LAADLRPLLD RIDGFISIER FQSLADPNKL LSLSFWRDEE        60
     AVKAWRNGAE HRAAQGAGRN GVFADYRLRI AAVVRDYGLN HRDEAPADSR QWHEGNAA         118
//

If you have problems or comments...

PBIL Back to PBIL home page