(data stored in ACNUC7421 zone)

EMBL: CP001389.PE545

CP001389.PE545       Location/Qualifiers
FT   CDS             607776..609026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05530"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13i"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24349"
FT                   /db_xref="GOA:C3M8X8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3M8X8"
FT                   /protein_id="ACP24349.1"
FT                   /translation="MTDQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAEL
FT                   AAWLTATSGATEAGQIQVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAK
FT                   DDSRDAEVMASALRTDRRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLW
FT                   RYFPALLELENDLGAEWLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAV
FT                   LRTPPVKVAAGTTEAASAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQR
FT                   KQHDVEILASLPGVGRIVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIR
FT                   RQACHDRLANAMYHWARVAIQHDSRSRLKYAALRSRGHSHGRALRSVADRLLNVACAML
FT                   KTGTTFNPSLAEQKLSC"
     MTDQKQFYAG VDWASESHHV FLTDGDGRKI GERVFRHGGE GLAELAAWLT ATSGATEAGQ        60
     IQVAIEVPHG PVVETLIERG CQVHAINPKQ MDRFRDRFTL AGAKDDSRDA EVMASALRTD       120
     RRCFRLLAAA DPVVIELREW SRMAEDLGAE RNRLTNRMRE QLWRYFPALL ELENDLGAEW       180
     LLDLWEAVPT PAKAARIRAA TIAKLLKRNR IRRVDATHVL AVLRTPPVKV AAGTTEAASA       240
     HIATLIARIR LVNRQLKQAH QRLDTLTARL VPTEATEPGQ RKQHDVEILA SLPGVGRIVL       300
     ATLLAEAFDA LQRRDHAALR SLTGVAPVTK RSGKSCIVIR RQACHDRLAN AMYHWARVAI       360
     QHDSRSRLKY AALRSRGHSH GRALRSVADR LLNVACAMLK TGTTFNPSLA EQKLSC           416
//

If you have problems or comments...

PBIL Back to PBIL home page