(data stored in ACNUC7421 zone)

EMBL: CP001389.PE546

CP001389.PE546       Location/Qualifiers
FT   CDS             complement(609118..610155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24350"
FT                   /db_xref="GOA:C3MHM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM2"
FT                   /protein_id="ACP24350.1"
FT                   /translation="MVTRIYGSNFADILKQNSYIEVEIYGYDGDDDIYLNRTDSYGGYN
FT                   FVDAGYGNDLVVNYYEGGNDIYMGAGNDIYVADIRARDTSSYDVVYGGSGNDRFEINGY
FT                   ASDYYGESGNDTFLSAGFNNYFNGGTGIDAISYQFQDDWSSERGKGVTIDLGYKYATTG
FT                   SGRREDLISIENATGTNYGHDDIAGSSVANTLRGLGGHDILEGLGGDDFLDGGSGDDDL
FT                   YGGSGADILRGGTGFDYLVGGTGTDSFDFNAISESVVGSRRDVIADFHRSEYDVIDLST
FT                   IDADTTWSGNQKFTYIGGSAFTGDAGQLNFRSGILSGDINGDGLADFQIKVNGVTSLRV
FT                   DDFFL"
     MVTRIYGSNF ADILKQNSYI EVEIYGYDGD DDIYLNRTDS YGGYNFVDAG YGNDLVVNYY        60
     EGGNDIYMGA GNDIYVADIR ARDTSSYDVV YGGSGNDRFE INGYASDYYG ESGNDTFLSA       120
     GFNNYFNGGT GIDAISYQFQ DDWSSERGKG VTIDLGYKYA TTGSGRREDL ISIENATGTN       180
     YGHDDIAGSS VANTLRGLGG HDILEGLGGD DFLDGGSGDD DLYGGSGADI LRGGTGFDYL       240
     VGGTGTDSFD FNAISESVVG SRRDVIADFH RSEYDVIDLS TIDADTTWSG NQKFTYIGGS       300
     AFTGDAGQLN FRSGILSGDI NGDGLADFQI KVNGVTSLRV DDFFL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page