(data stored in ACNUC7421 zone)

EMBL: CP001389.PE549

CP001389.PE549       Location/Qualifiers
FT   CDS             612449..612955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24353"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM5"
FT                   /protein_id="ACP24353.1"
FT                   /translation="MSEAKSRKGVVQISEVANGLIDPVLAKRAGINTMLLGSWDEIAGT
FT                   EFADCTRPEKIAWPRRASEIGGDGGYQPGVLTVACEGARALFLTHAQGELIQRINGFFG
FT                   FHAIGQLRIVQKPVAAPPKPYRRPRPLTGEPARRLDTMVEGIESEALRSALKRLGTAVL
FT                   SERRK"
     MSEAKSRKGV VQISEVANGL IDPVLAKRAG INTMLLGSWD EIAGTEFADC TRPEKIAWPR        60
     RASEIGGDGG YQPGVLTVAC EGARALFLTH AQGELIQRIN GFFGFHAIGQ LRIVQKPVAA       120
     PPKPYRRPRP LTGEPARRLD TMVEGIESEA LRSALKRLGT AVLSERRK                    168
//

If you have problems or comments...

PBIL Back to PBIL home page