(data stored in ACNUC7421 zone)

EMBL: CP001389.PE55

CP001389.PE55        Location/Qualifiers
FT   CDS             complement(58848..60056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00550"
FT                   /product="putative DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23859"
FT                   /db_xref="GOA:C3MF22"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF22"
FT                   /protein_id="ACP23859.1"
FT                   /translation="MEPIAFSFDQPLFLIGSFPVTAGHLVILAAFLFVLAAIAAARRAR
FT                   MLRADDRDQQLSALLAAQTEMQGRIAAMADVFGARQAELNQSLSQRIDGMTHRIGASIS
FT                   EQTKATHENLRRLQERLAVIDSAQNNIQSLAKDMAGLQSILSNKQTRGAFGQSRMEAIV
FT                   ADGLPIGAFTFQSTLSNGARPDCIIRMPNGQPPLVIDAKFPLEAWNAMRDADSAERRHQ
FT                   ASQAFRRDMEVHIRDIASKYLLAGETQDTAFLFVPSESIFAEIHEHFEAIVQKAHRQRV
FT                   VIVSPSLLLLSIQVIQAILKDARMREQAHLIQGEVVRLMEDLTRLDERVRKLQGHFAMT
FT                   QKDVEDILISSDKLTRRGAKIEALELEAITSANHADKPIGDKADRTVDNRVGQLKLRVV
FT                   DED"
     MEPIAFSFDQ PLFLIGSFPV TAGHLVILAA FLFVLAAIAA ARRARMLRAD DRDQQLSALL        60
     AAQTEMQGRI AAMADVFGAR QAELNQSLSQ RIDGMTHRIG ASISEQTKAT HENLRRLQER       120
     LAVIDSAQNN IQSLAKDMAG LQSILSNKQT RGAFGQSRME AIVADGLPIG AFTFQSTLSN       180
     GARPDCIIRM PNGQPPLVID AKFPLEAWNA MRDADSAERR HQASQAFRRD MEVHIRDIAS       240
     KYLLAGETQD TAFLFVPSES IFAEIHEHFE AIVQKAHRQR VVIVSPSLLL LSIQVIQAIL       300
     KDARMREQAH LIQGEVVRLM EDLTRLDERV RKLQGHFAMT QKDVEDILIS SDKLTRRGAK       360
     IEALELEAIT SANHADKPIG DKADRTVDNR VGQLKLRVVD ED                          402
//

If you have problems or comments...

PBIL Back to PBIL home page