(data stored in ACNUC7421 zone)

EMBL: CP001389.PE550

CP001389.PE550       Location/Qualifiers
FT   CDS             613077..613883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05580"
FT                   /product="putative disulfide bond formation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24354"
FT                   /db_xref="GOA:C3MHM6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM6"
FT                   /protein_id="ACP24354.1"
FT                   /translation="MSASVTSLPKRLLSGVAIAALALVLAACSEEKKEAASKAPAETSA
FT                   SADAMTTASTTATPAASRAKPAGTEVAQAAAPAKAELPQSEGSVDVQKLMEPGALPEMA
FT                   LGEANAPVTIVEYMSMTCPHCANFHNKTFDAIKAKYIDSGKVRFIVREFPFDPRAAAAF
FT                   MLARCAPEGQYFPMVSMLFKQQEQWAAAENGRDALLQMSKLAGFTQESFEACLTNQKLL
FT                   DDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDMSVDVLSALIDSKL"
     MSASVTSLPK RLLSGVAIAA LALVLAACSE EKKEAASKAP AETSASADAM TTASTTATPA        60
     ASRAKPAGTE VAQAAAPAKA ELPQSEGSVD VQKLMEPGAL PEMALGEANA PVTIVEYMSM       120
     TCPHCANFHN KTFDAIKAKY IDSGKVRFIV REFPFDPRAA AAFMLARCAP EGQYFPMVSM       180
     LFKQQEQWAA AENGRDALLQ MSKLAGFTQE SFEACLTNQK LLDDVNAVMQ RGAKEFGVKS       240
     TPTFFVNGEH YSGDMSVDVL SALIDSKL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page