(data stored in ACNUC7421 zone)

EMBL: CP001389.PE551

CP001389.PE551       Location/Qualifiers
FT   CDS             613970..614341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24355"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM7"
FT                   /protein_id="ACP24355.1"
FT                   /translation="MPHADVPPKARANARRMRSAMTDAELKLWSELRAHRLLGLAFRRQ
FT                   VPVAGYIVDFACAEHRLIIEVDGSQHASTGNADYDRQRTQHFESHGWTVLRFWNDDVLS
FT                   DIDNVCEHIVRVIGKGAFK"
     MPHADVPPKA RANARRMRSA MTDAELKLWS ELRAHRLLGL AFRRQVPVAG YIVDFACAEH        60
     RLIIEVDGSQ HASTGNADYD RQRTQHFESH GWTVLRFWND DVLSDIDNVC EHIVRVIGKG       120
     AFK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page