(data stored in ACNUC7421 zone)

EMBL: CP001389.PE552

CP001389.PE552       Location/Qualifiers
FT   CDS             614565..618026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05610"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24356"
FT                   /db_xref="GOA:C3MHM8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM8"
FT                   /protein_id="ACP24356.1"
FT                   /translation="MKFNKLRLLGFKSFVEPTEFIIERGLTGVVGPNGCGKSNLVEALR
FT                   WVMGENSYKNMRASGMDDVIFSGSGNRPARNTAEVGLYLDNSDRTAPAAFNDSDEIQVT
FT                   RRIEREQGSVYRINGKEARAKDVQLLFADASTGARSPSMVGQGRIGELIAAKPQARRQL
FT                   LEEAAGISGLHSRRHEAELRLKAAETNLERLDDVTSQLESQIESLKRQSRQANRFKMLS
FT                   AEIRRHEAILLHIRWVQAKEAESEAASQLNQITALVAEKAQAQMEAAKHQAIASLKLPE
FT                   LRENEAKLAAALQRLQIARAQLEEDAGRILRRRDELQRRLSQLAEDIAREERLVADNSG
FT                   ILSRLDEEEEELKEVLAEADDRAAEAREKLVEAGEKLSDSEADLARLTAERAEAQAARN
FT                   QLDRTLRDLSERQARLARQLSDQARDLEALDRQMAALPDPHEKQEQVEAAEAALEEAEA
FT                   VVVAVEESLAEARAEEAATRPPVDQARALLNGIETEARTIRRMLEASGASDYPAVVEDM
FT                   QVERGFETALGAALGDDLDSPLEQAAASHWRMPGDDADDPALPRGALPLSDYVSAPEAL
FT                   GRTLRQIGIVESETEAERLLPLLKSGQRLVTKEGAVWRWDGHVTGSEAPSAAALRLAQK
FT                   NRLSELEAEAEDAAGALRQAEADLAAAGARIRAEDERLRLSRDAQRMITRQLAEARDAL
FT                   AAAERASGDLARRRAVLAETKLQLEGQVEEAAEQIEAANDALAEAPDLAELELRLRART
FT                   ADVAADRAAVAEARATHDGLARETEARLRRLSAIAGERETWRARASSAEEHIATLRDRE
FT                   AEAREEVEELIDAPDEFEDKRRALMNELQKAETARRQAADILAEAETRQREADRLAATA
FT                   LSELAEAREKRGRAEERLVSARERRVEIEARILEALSCPPHEAMRLTGLAADAALPDMR
FT                   AIERELERLKIERERLGAVNLRADEEQKELSERLAALLKERDDVIEAIRKLRSAIQNLN
FT                   REGRERLIAAFDVVNVQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQT
FT                   MTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTET
FT                   RFIIITHNPITMARMNRLFGVTMAEQGVSQLVSVDLQTAERMREAV"
     MKFNKLRLLG FKSFVEPTEF IIERGLTGVV GPNGCGKSNL VEALRWVMGE NSYKNMRASG        60
     MDDVIFSGSG NRPARNTAEV GLYLDNSDRT APAAFNDSDE IQVTRRIERE QGSVYRINGK       120
     EARAKDVQLL FADASTGARS PSMVGQGRIG ELIAAKPQAR RQLLEEAAGI SGLHSRRHEA       180
     ELRLKAAETN LERLDDVTSQ LESQIESLKR QSRQANRFKM LSAEIRRHEA ILLHIRWVQA       240
     KEAESEAASQ LNQITALVAE KAQAQMEAAK HQAIASLKLP ELRENEAKLA AALQRLQIAR       300
     AQLEEDAGRI LRRRDELQRR LSQLAEDIAR EERLVADNSG ILSRLDEEEE ELKEVLAEAD       360
     DRAAEAREKL VEAGEKLSDS EADLARLTAE RAEAQAARNQ LDRTLRDLSE RQARLARQLS       420
     DQARDLEALD RQMAALPDPH EKQEQVEAAE AALEEAEAVV VAVEESLAEA RAEEAATRPP       480
     VDQARALLNG IETEARTIRR MLEASGASDY PAVVEDMQVE RGFETALGAA LGDDLDSPLE       540
     QAAASHWRMP GDDADDPALP RGALPLSDYV SAPEALGRTL RQIGIVESET EAERLLPLLK       600
     SGQRLVTKEG AVWRWDGHVT GSEAPSAAAL RLAQKNRLSE LEAEAEDAAG ALRQAEADLA       660
     AAGARIRAED ERLRLSRDAQ RMITRQLAEA RDALAAAERA SGDLARRRAV LAETKLQLEG       720
     QVEEAAEQIE AANDALAEAP DLAELELRLR ARTADVAADR AAVAEARATH DGLARETEAR       780
     LRRLSAIAGE RETWRARASS AEEHIATLRD REAEAREEVE ELIDAPDEFE DKRRALMNEL       840
     QKAETARRQA ADILAEAETR QREADRLAAT ALSELAEARE KRGRAEERLV SARERRVEIE       900
     ARILEALSCP PHEAMRLTGL AADAALPDMR AIERELERLK IERERLGAVN LRADEEQKEL       960
     SERLAALLKE RDDVIEAIRK LRSAIQNLNR EGRERLIAAF DVVNVQFQRL FTHLFGGGTA      1020
     ELQLIESDDP LEAGLEILAR PPGKKPQTMT LLSGGEQALT AMALIFAVFL TNPAPICVLD      1080
     EVDAPLDDHN VERYCNLMDE MAASTETRFI IITHNPITMA RMNRLFGVTM AEQGVSQLVS      1140
     VDLQTAERMR EAV                                                         1153
//

If you have problems or comments...

PBIL Back to PBIL home page