(data stored in ACNUC7421 zone)

EMBL: CP001389.PE554

CP001389.PE554       Location/Qualifiers
FT   CDS             complement(620916..621161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24358"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN0"
FT                   /protein_id="ACP24358.1"
FT                   /translation="MTMMTTRLLTLAAAGLVLAGCQTVTPQERRARDETTCASYGFRRG
FT                   TDSFATCLQRIELDRRAEARAFRYDNDFLMRRPYYW"
     MTMMTTRLLT LAAAGLVLAG CQTVTPQERR ARDETTCASY GFRRGTDSFA TCLQRIELDR        60
     RAEARAFRYD NDFLMRRPYY W                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page