(data stored in ACNUC7421 zone)

EMBL: CP001389.PE556

CP001389.PE556       Location/Qualifiers
FT   CDS             622025..622933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05650"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24360"
FT                   /db_xref="GOA:C3MHN2"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN2"
FT                   /protein_id="ACP24360.1"
FT                   /translation="MMVRYERPYSHAAHWARRLARIGFVIFALSLAAHRFGPLTTPHFL
FT                   ALAGCAVAFALLAVLLATVGLTRLWKVAAIGGTASVSALFYAALPLGFFLHGAAQYLAR
FT                   PAIYDVSTDPVTPPPWIKAPVAEESWITRRPIVTPEDREAQIAAYPGLTGRRYDGALDR
FT                   VFQSVRKVVEERRIATTAELGVENARADLEDLAVGPGAGADTNREPEAIPVPATRPAPD
FT                   IEAGIPGRDASDIVLQGEWRTLIAGFRFDVLIRLREEAETTLVDLRVASRYGQHDLGMG
FT                   AKFAEEFLRALDAELLGIAGD"
     MMVRYERPYS HAAHWARRLA RIGFVIFALS LAAHRFGPLT TPHFLALAGC AVAFALLAVL        60
     LATVGLTRLW KVAAIGGTAS VSALFYAALP LGFFLHGAAQ YLARPAIYDV STDPVTPPPW       120
     IKAPVAEESW ITRRPIVTPE DREAQIAAYP GLTGRRYDGA LDRVFQSVRK VVEERRIATT       180
     AELGVENARA DLEDLAVGPG AGADTNREPE AIPVPATRPA PDIEAGIPGR DASDIVLQGE       240
     WRTLIAGFRF DVLIRLREEA ETTLVDLRVA SRYGQHDLGM GAKFAEEFLR ALDAELLGIA       300
     GD                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page