(data stored in ACNUC7421 zone)

EMBL: CP001389.PE557

CP001389.PE557       Location/Qualifiers
FT   CDS             complement(622941..623852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05660"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24361"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN3"
FT                   /protein_id="ACP24361.1"
FT                   /translation="MQGPDFDLDFKPAHGEKVTVAEGVERITVNNPGPFTFHGTNSYIV
FT                   GRHSVAVIDPGPEDEAHFQGLMAALAGREVTHIAVSHTHRDHSPLVRRLKEATGAVVVG
FT                   EGPHRAARPLHAGETNPFAESSDMEFVPDVALRDGARIEGDGWSLTAIATPGHTANHMA
FT                   FGLDGTGILFSADHVMAWATSIVAPPDGAMADYMASLDKLLSRDDRLYLPGHGGPVSEP
FT                   PAFLRALKAHRKMRERAVLERLRAGDRNIPDMVKVIYASTDPRLHGAAALSVLAHIEDL
FT                   IEQGRIETDGPPSLLGEYRLVT"
     MQGPDFDLDF KPAHGEKVTV AEGVERITVN NPGPFTFHGT NSYIVGRHSV AVIDPGPEDE        60
     AHFQGLMAAL AGREVTHIAV SHTHRDHSPL VRRLKEATGA VVVGEGPHRA ARPLHAGETN       120
     PFAESSDMEF VPDVALRDGA RIEGDGWSLT AIATPGHTAN HMAFGLDGTG ILFSADHVMA       180
     WATSIVAPPD GAMADYMASL DKLLSRDDRL YLPGHGGPVS EPPAFLRALK AHRKMRERAV       240
     LERLRAGDRN IPDMVKVIYA STDPRLHGAA ALSVLAHIED LIEQGRIETD GPPSLLGEYR       300
     LVT                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page