(data stored in ACNUC7421 zone)

EMBL: CP001389.PE558

CP001389.PE558       Location/Qualifiers
FT   CDS             complement(623864..624160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24362"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN4"
FT                   /protein_id="ACP24362.1"
FT                   /translation="MTKFRARPPAVPTVLVDDAVVRIIRWDFEPGADTGHHVHGLGYVV
FT                   VPMTDCQFLVEEEEGSRRIDVAKGAAYRRDAGVAHNVVNAGSEPMSFVEIEYK"
     MTKFRARPPA VPTVLVDDAV VRIIRWDFEP GADTGHHVHG LGYVVVPMTD CQFLVEEEEG        60
     SRRIDVAKGA AYRRDAGVAH NVVNAGSEPM SFVEIEYK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page