(data stored in ACNUC7421 zone)

EMBL: CP001389.PE559

CP001389.PE559       Location/Qualifiers
FT   CDS             complement(624613..625893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24363"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN5"
FT                   /protein_id="ACP24363.1"
FT                   /translation="MPTEQDLGRLQFTTLLYYLQCTNPDNGLVRDKTEPNAPASIAAIG
FT                   MALATIPVVVERGVIIRKFAAKIARKRLEFLLGCPQGPEPDASGYKGFFYHFLDIETGR
FT                   RVWECELSTIDSAFLFAGALTAAAYFDGEDADEAKIRMLANALYERADWNWACDHGLTL
FT                   THGWRPESGFIPYRWRGYDEGLLLYILGLGSPTHPLPPEAYAAYTESYEWRNIYGRELL
FT                   YSGPLFTHQLSHMWIDFRGIRDAFMRDRDTDYFQNSRQATYVQQEYAIRNPMNFRGYGE
FT                   HCWGFTACDGPGWTKKQLDGVEREFFDYIARGAPFGPDDGTVSPWVVVASLPFAPEIVI
FT                   PTVRNFAQMNLGMTHLYGFKPSFNQTYAVEGNDAGWWVSPYHFGIDQGPVVLMIENFRT
FT                   GLLWNIMRRSQPIVTGLRRAGFTGGWL"
     MPTEQDLGRL QFTTLLYYLQ CTNPDNGLVR DKTEPNAPAS IAAIGMALAT IPVVVERGVI        60
     IRKFAAKIAR KRLEFLLGCP QGPEPDASGY KGFFYHFLDI ETGRRVWECE LSTIDSAFLF       120
     AGALTAAAYF DGEDADEAKI RMLANALYER ADWNWACDHG LTLTHGWRPE SGFIPYRWRG       180
     YDEGLLLYIL GLGSPTHPLP PEAYAAYTES YEWRNIYGRE LLYSGPLFTH QLSHMWIDFR       240
     GIRDAFMRDR DTDYFQNSRQ ATYVQQEYAI RNPMNFRGYG EHCWGFTACD GPGWTKKQLD       300
     GVEREFFDYI ARGAPFGPDD GTVSPWVVVA SLPFAPEIVI PTVRNFAQMN LGMTHLYGFK       360
     PSFNQTYAVE GNDAGWWVSP YHFGIDQGPV VLMIENFRTG LLWNIMRRSQ PIVTGLRRAG       420
     FTGGWL                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page