(data stored in ACNUC7421 zone)

EMBL: CP001389.PE561

CP001389.PE561       Location/Qualifiers
FT   CDS             628990..629166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24365"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN7"
FT                   /protein_id="ACP24365.1"
FT                   /translation="MAHKFEIFKDKAGEYRVRFKYNNEVMFASEGYAGKASAQNAIESI
FT                   KKNGPDAPVEDNT"
     MAHKFEIFKD KAGEYRVRFK YNNEVMFASE GYAGKASAQN AIESIKKNGP DAPVEDNT          58
//

If you have problems or comments...

PBIL Back to PBIL home page