(data stored in ACNUC7421 zone)

EMBL: CP001389.PE562

CP001389.PE562       Location/Qualifiers
FT   CDS             complement(629237..629650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN8"
FT                   /protein_id="ACP24366.1"
FT                   /translation="MNFRMMTAAGLVLALAGCTTTTGVARNAVEKRWLGQPAGTYFAQF
FT                   GPPLSDVETGGDTVYSWKGGYKTRRIPAEYEKTADGKRGKRISAARTEYLSCAVQLTVS
FT                   SDYVIRSIRIAGDRKRPTGPSWCEEFLGGAKAE"
     MNFRMMTAAG LVLALAGCTT TTGVARNAVE KRWLGQPAGT YFAQFGPPLS DVETGGDTVY        60
     SWKGGYKTRR IPAEYEKTAD GKRGKRISAA RTEYLSCAVQ LTVSSDYVIR SIRIAGDRKR       120
     PTGPSWCEEF LGGAKAE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page