(data stored in ACNUC7421 zone)

EMBL: CP001389.PE563

CP001389.PE563       Location/Qualifiers
FT   CDS             complement(630053..630334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24367"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN9"
FT                   /protein_id="ACP24367.1"
FT                   /translation="MKPTVRGEDGHRCASCCRGGRDLRSYRTERSNSRSTSAKLSTSRI
FT                   SEAAKENCRRNDWELKPAGETKWQFKTPKQRFCQNFCQIFEREFLSAQ"
     MKPTVRGEDG HRCASCCRGG RDLRSYRTER SNSRSTSAKL STSRISEAAK ENCRRNDWEL        60
     KPAGETKWQF KTPKQRFCQN FCQIFEREFL SAQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page