(data stored in ACNUC7421 zone)

EMBL: CP001389.PE564

CP001389.PE564       Location/Qualifiers
FT   CDS             630425..630739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24368"
FT                   /db_xref="GOA:C3MHP0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP0"
FT                   /protein_id="ACP24368.1"
FT                   /translation="MANFGAPAHTAALGNAAGMMIIAAGALGLANAVGDGLRAAKEARY
FT                   QARYNDALDTAISHAEQMEALARTAMELLAELEGDNKRLRAACRQRQEVIDLLKARGRV
FT                   "
     MANFGAPAHT AALGNAAGMM IIAAGALGLA NAVGDGLRAA KEARYQARYN DALDTAISHA        60
     EQMEALARTA MELLAELEGD NKRLRAACRQ RQEVIDLLKA RGRV                        104
//

If you have problems or comments...

PBIL Back to PBIL home page