(data stored in ACNUC7421 zone)

EMBL: CP001389.PE568

CP001389.PE568       Location/Qualifiers
FT   CDS             631821..633266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24372"
FT                   /db_xref="GOA:C3MI24"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI24"
FT                   /protein_id="ACP24372.1"
FT                   /translation="MDIVFTAGIFARDLVLALASLLKQPPAPGLFSLFLVILLVIATLW
FT                   FWAVVRRRVGLLRRATKLVRKSRGPEEFRERFQETYDELTSWSGADAGRLADTWDEFRE
FT                   TTIESQGQTGIRNAIRPSVFFNLEEMGFSVSGWRVVPSLFVSVGLAATFLGLIAALQET
FT                   GNSLSAGGDQAAVMKALTQLLTVASAKFIMSLTGLLCSIVFTVVMRVRSSGLEQEMRTL
FT                   THAIETRMSFVSLEDLAEKQLKAIVEQRDHMQKLNHELIAAISEPLQKAAASGINHVDE
FT                   MVQSLAGSLTQGLVGAMSATSERLEAASGRLEGLAATLSGAAQEFSQAAERTAVGLDGA
FT                   ARRLELVSDNLARAGNGLAQAAVPVAESANKTAEATQQIASSSINMVESARQTMSSERE
FT                   MVVAAANSIREHIKSFETRAAAYDGQLAAAFRTFTEQISRSIGEVENHANNVHGQYTEA
FT                   LSTLQGVIENAKAFTPESARPSA"
     MDIVFTAGIF ARDLVLALAS LLKQPPAPGL FSLFLVILLV IATLWFWAVV RRRVGLLRRA        60
     TKLVRKSRGP EEFRERFQET YDELTSWSGA DAGRLADTWD EFRETTIESQ GQTGIRNAIR       120
     PSVFFNLEEM GFSVSGWRVV PSLFVSVGLA ATFLGLIAAL QETGNSLSAG GDQAAVMKAL       180
     TQLLTVASAK FIMSLTGLLC SIVFTVVMRV RSSGLEQEMR TLTHAIETRM SFVSLEDLAE       240
     KQLKAIVEQR DHMQKLNHEL IAAISEPLQK AAASGINHVD EMVQSLAGSL TQGLVGAMSA       300
     TSERLEAASG RLEGLAATLS GAAQEFSQAA ERTAVGLDGA ARRLELVSDN LARAGNGLAQ       360
     AAVPVAESAN KTAEATQQIA SSSINMVESA RQTMSSEREM VVAAANSIRE HIKSFETRAA       420
     AYDGQLAAAF RTFTEQISRS IGEVENHANN VHGQYTEALS TLQGVIENAK AFTPESARPS       480
     A                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page