(data stored in ACNUC7421 zone)

EMBL: CP001389.PE569

CP001389.PE569       Location/Qualifiers
FT   CDS             633263..634192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05800"
FT                   /product="OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24373"
FT                   /db_xref="GOA:C3MI25"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI25"
FT                   /protein_id="ACP24373.1"
FT                   /translation="MRGRGGARRQEEEEESVFISMADMTISFLFILMILLAFFASQFNV
FT                   SDTVPRPLYDSLKDEKDRIQRDIDAIAEIVEANGRPVVTATREMKDELERLRKLLNTPE
FT                   KANKMEVYNSAVADARKNLLTSLKSEINSRIPGVNVAVSANYDALQFAGDGLFDSGKEV
FT                   PTTVGAVRMRQIAEVLDQNLGCYSLGSRRAFTENCNPAFALIDSLQVEGHTDSVGSEVL
FT                   NMDLSAKRAASIYALMIEQKPDLVLYQNRDEQPVLSVAGFGKGRPIQQNETESGRDANR
FT                   RIDLRFIMVVPSKETDIADIRRALSGEP"
     MRGRGGARRQ EEEEESVFIS MADMTISFLF ILMILLAFFA SQFNVSDTVP RPLYDSLKDE        60
     KDRIQRDIDA IAEIVEANGR PVVTATREMK DELERLRKLL NTPEKANKME VYNSAVADAR       120
     KNLLTSLKSE INSRIPGVNV AVSANYDALQ FAGDGLFDSG KEVPTTVGAV RMRQIAEVLD       180
     QNLGCYSLGS RRAFTENCNP AFALIDSLQV EGHTDSVGSE VLNMDLSAKR AASIYALMIE       240
     QKPDLVLYQN RDEQPVLSVA GFGKGRPIQQ NETESGRDAN RRIDLRFIMV VPSKETDIAD       300
     IRRALSGEP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page