(data stored in ACNUC7421 zone)

EMBL: CP001389.PE570

CP001389.PE570       Location/Qualifiers
FT   CDS             634194..635507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24374"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI26"
FT                   /protein_id="ACP24374.1"
FT                   /translation="MSLLETLRAMPHRKKFEGKSIEGLSQAVQAVFQAFPEFSRVSPAT
FT                   LEQMKAKIAAAVRDWEWGSVTVGEVGMLASAAFGRAEELDTQTLSFVRREVQATTNPVL
FT                   LDAAAEGYFAGWSRGGQLTRWLASIMQERSSHLSKRWQSVFVSIPQALDANHAPEHLAE
FT                   RMVMEPDPYRWLAGAGVASPHSGNLMQELHQAWLRTLPEIKTDAQVAHVFRWILPEGRA
FT                   RASDKMAASAIEKLLSPWLHKMPEQEYRKALLDRITDAYGDPRNKRPEFWSLVSAPCRG
FT                   VLVRWLAGASMDALLSVITKSTANHMWPPRHDFWKGLFNRGLVDEAWVALSPAAAAIAQ
FT                   DMFAKSVNAASMAAGRQTSKARKDTCLLVMRIGRYIVVEGSHDYRVHMFSDADSRAPKL
FT                   YQASYDAEALILGAGHPDTRIHDQPGHWKRWVEERVVR"
     MSLLETLRAM PHRKKFEGKS IEGLSQAVQA VFQAFPEFSR VSPATLEQMK AKIAAAVRDW        60
     EWGSVTVGEV GMLASAAFGR AEELDTQTLS FVRREVQATT NPVLLDAAAE GYFAGWSRGG       120
     QLTRWLASIM QERSSHLSKR WQSVFVSIPQ ALDANHAPEH LAERMVMEPD PYRWLAGAGV       180
     ASPHSGNLMQ ELHQAWLRTL PEIKTDAQVA HVFRWILPEG RARASDKMAA SAIEKLLSPW       240
     LHKMPEQEYR KALLDRITDA YGDPRNKRPE FWSLVSAPCR GVLVRWLAGA SMDALLSVIT       300
     KSTANHMWPP RHDFWKGLFN RGLVDEAWVA LSPAAAAIAQ DMFAKSVNAA SMAAGRQTSK       360
     ARKDTCLLVM RIGRYIVVEG SHDYRVHMFS DADSRAPKLY QASYDAEALI LGAGHPDTRI       420
     HDQPGHWKRW VEERVVR                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page