(data stored in ACNUC7421 zone)

EMBL: CP001389.PE571

CP001389.PE571       Location/Qualifiers
FT   CDS             635504..638722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05820"
FT                   /product="superfamily II DNA/RNA helicase and SNF2
FT                   family-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24375"
FT                   /db_xref="GOA:C3MI27"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI27"
FT                   /protein_id="ACP24375.1"
FT                   /translation="MIKFDFRADSQAAYVTVAPEKRGWLAAFRRREAVDLRALTKAERA
FT                   TALAVARLRHLDPLGELHQIAENGLVIRHPLVAQLDSNTASALGLPRLMTGYVFKAKLA
FT                   GTVGSSDFGIDWWWEKNGRTVALPLQGAFLGSAAQMMRLPSQIYSAIEQANALKERSSV
FT                   TDHWLELGKFRRLFDASDEPASRENLEGFLRNLSVVTCDSVGIAFDAEDETKFFPLPFV
FT                   GSPEPDPDRDTADVAALKGRELNEFRDGAIRRGAQPAYRVADGKFLIVDRSAAPVLDAI
FT                   ARNAKADEAGRRAFIADAGRIIQSAIERQMEDDGRITALMSPAARAERVEQETSRVWIE
FT                   TTEWVSRVLGVAKWQVTEIEGMQSSGTKWLNSSIDAELADRLSQIEDEQLAEVVEALRT
FT                   AIAEHTPLITHEVGDIPAIAEVLEALSRRLAEYLRQKPIDAPSVSLDAYLPVTHDNFWE
FT                   VDFKAAVRPRGNEAEFKFPEAVRTALQPHQLTSLKWQVAAWQAGIPGVLNADEQGLGKT
FT                   LQTLSFVAWLRAEMDAGAVPHRPFLVVAPTSLLLNWEAEIDRHLSAQALGIPVRLYGSH
FT                   LAEFKKEGLSGQDIREGEALLDLDKIRSLENGAPVVITTYQTLANFAISLMDLQCAVAI
FT                   FDEIQFVKNPVTMRAKAAKSLNADFRIGLTGTPIENATKDLWALMDQLFPGALGALAQF
FT                   KRVFGLPTEENMSALHHALFSGQHERPPLALRRLKTDAAPGLPTKVRILHPREMSEPQM
FT                   LRYDEARRKGGMMLALLHHIRRISLHPGLLEGETTEEFSASAARVDAAMDILRHIKSKG
FT                   ERALVFVENRDVQAWFAEVVRLEFNLDTVMIINGDTTIDARKEITDRFQRHLTNDGGFD
FT                   VLVLGPRAAGTGLTLTAANHVIHLSRWWNPAVEEQCNDRTHRIGQTKPVTVHIPLAVHT
FT                   RLGAGSFDCLLQRLMKRKRTIADRVLWPAEATESETRMLYDAVVEASDVEVGSEALELD
FT                   GVLEGRTDLTAEMLDGNAIRIRPRRGGASIVVSSGRTVPSSSIRSDTDAAVVSMQVHGV
FT                   GKEMPVPHSRLTTGTLWPEFVLPE"
     MIKFDFRADS QAAYVTVAPE KRGWLAAFRR REAVDLRALT KAERATALAV ARLRHLDPLG        60
     ELHQIAENGL VIRHPLVAQL DSNTASALGL PRLMTGYVFK AKLAGTVGSS DFGIDWWWEK       120
     NGRTVALPLQ GAFLGSAAQM MRLPSQIYSA IEQANALKER SSVTDHWLEL GKFRRLFDAS       180
     DEPASRENLE GFLRNLSVVT CDSVGIAFDA EDETKFFPLP FVGSPEPDPD RDTADVAALK       240
     GRELNEFRDG AIRRGAQPAY RVADGKFLIV DRSAAPVLDA IARNAKADEA GRRAFIADAG       300
     RIIQSAIERQ MEDDGRITAL MSPAARAERV EQETSRVWIE TTEWVSRVLG VAKWQVTEIE       360
     GMQSSGTKWL NSSIDAELAD RLSQIEDEQL AEVVEALRTA IAEHTPLITH EVGDIPAIAE       420
     VLEALSRRLA EYLRQKPIDA PSVSLDAYLP VTHDNFWEVD FKAAVRPRGN EAEFKFPEAV       480
     RTALQPHQLT SLKWQVAAWQ AGIPGVLNAD EQGLGKTLQT LSFVAWLRAE MDAGAVPHRP       540
     FLVVAPTSLL LNWEAEIDRH LSAQALGIPV RLYGSHLAEF KKEGLSGQDI REGEALLDLD       600
     KIRSLENGAP VVITTYQTLA NFAISLMDLQ CAVAIFDEIQ FVKNPVTMRA KAAKSLNADF       660
     RIGLTGTPIE NATKDLWALM DQLFPGALGA LAQFKRVFGL PTEENMSALH HALFSGQHER       720
     PPLALRRLKT DAAPGLPTKV RILHPREMSE PQMLRYDEAR RKGGMMLALL HHIRRISLHP       780
     GLLEGETTEE FSASAARVDA AMDILRHIKS KGERALVFVE NRDVQAWFAE VVRLEFNLDT       840
     VMIINGDTTI DARKEITDRF QRHLTNDGGF DVLVLGPRAA GTGLTLTAAN HVIHLSRWWN       900
     PAVEEQCNDR THRIGQTKPV TVHIPLAVHT RLGAGSFDCL LQRLMKRKRT IADRVLWPAE       960
     ATESETRMLY DAVVEASDVE VGSEALELDG VLEGRTDLTA EMLDGNAIRI RPRRGGASIV      1020
     VSSGRTVPSS SIRSDTDAAV VSMQVHGVGK EMPVPHSRLT TGTLWPEFVL PE              1072
//

If you have problems or comments...

PBIL Back to PBIL home page