(data stored in ACNUC7421 zone)

EMBL: CP001389.PE574

CP001389.PE574       Location/Qualifiers
FT   CDS             complement(640908..642362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24378"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI30"
FT                   /protein_id="ACP24378.1"
FT                   /translation="MTHAENDRSAALKIRGMTYPLTLQLSLYADLLRVMQGIAPENVYV
FT                   VVPWANFVPQTFRVADYGAFFRKARRAAEEATGAGSGEHYPEPTEHCDICRWADACQTR
FT                   WRKDDHLSLVANISKSQIAELRAHAVSTTKALAQLPSPFPWKPDRGSAASFEKTRAQAH
FT                   IQVSAREAGELLYDLLEVVPDTGLCRLPEPSLGDIFFDIEGDPFIGEHGLEYLFGYHYR
FT                   NEAGDYVRLANWAFDRNTEKAIFERFMDFVTSRREQFPDLHIYHYAPYEPATLKRLMGR
FT                   YATRESEVDRLLRGNVLVDLYTVVRNAVRASVESYSIKKLEAFYGFVRATPLREANVAL
FT                   TALQVALQVNDVVSVSDEIKAVVATYNDDDCRSTEALRDWLEQLRTEIIASGTAVERPA
FT                   PEKDEPSEDLSESEARVAALIGALTYNVPVDVAERTAAEHGKWILAYCLDWHRREAKSN
FT                   WWEYFRLGDLTSEELLDEKAGLGGPI"
     MTHAENDRSA ALKIRGMTYP LTLQLSLYAD LLRVMQGIAP ENVYVVVPWA NFVPQTFRVA        60
     DYGAFFRKAR RAAEEATGAG SGEHYPEPTE HCDICRWADA CQTRWRKDDH LSLVANISKS       120
     QIAELRAHAV STTKALAQLP SPFPWKPDRG SAASFEKTRA QAHIQVSARE AGELLYDLLE       180
     VVPDTGLCRL PEPSLGDIFF DIEGDPFIGE HGLEYLFGYH YRNEAGDYVR LANWAFDRNT       240
     EKAIFERFMD FVTSRREQFP DLHIYHYAPY EPATLKRLMG RYATRESEVD RLLRGNVLVD       300
     LYTVVRNAVR ASVESYSIKK LEAFYGFVRA TPLREANVAL TALQVALQVN DVVSVSDEIK       360
     AVVATYNDDD CRSTEALRDW LEQLRTEIIA SGTAVERPAP EKDEPSEDLS ESEARVAALI       420
     GALTYNVPVD VAERTAAEHG KWILAYCLDW HRREAKSNWW EYFRLGDLTS EELLDEKAGL       480
     GGPI                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page