(data stored in ACNUC7421 zone)

EMBL: CP001389.PE575

CP001389.PE575       Location/Qualifiers
FT   CDS             642375..642761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05860"
FT                   /product="putative transposase number 1 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24379"
FT                   /db_xref="GOA:C3MI31"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI31"
FT                   /protein_id="ACP24379.1"
FT                   /translation="MSDSVNHHRTFEVLTAEPVRSRRKPRHWSDEEKAQLVAEALSPGA
FT                   NVSAIARSQGLDPSQLYAWRRKALSSGMVAPLTEGPSAPVKFTRFEAVSSSMVEIVVGD
FT                   VVVRAGGDVDADHLAKILRVVRTA"
     MSDSVNHHRT FEVLTAEPVR SRRKPRHWSD EEKAQLVAEA LSPGANVSAI ARSQGLDPSQ        60
     LYAWRRKALS SGMVAPLTEG PSAPVKFTRF EAVSSSMVEI VVGDVVVRAG GDVDADHLAK       120
     ILRVVRTA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page