(data stored in ACNUC7421 zone)

EMBL: CP001389.PE576

CP001389.PE576       Location/Qualifiers
FT   CDS             642758..643102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05870"
FT                   /product="putative transposase number 2 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24380"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI32"
FT                   /protein_id="ACP24380.1"
FT                   /translation="MIASGVVVYVSCQPVDFRKGAASLMALVRDGGLDPFNGSLYVFRS
FT                   KRADRVRIVWWDGSGVCLYSKTLEEQGFCWPGISAARMRLDHPQLMALLAGLDWKKIRP
FT                   AKIRRPLLTG"
     MIASGVVVYV SCQPVDFRKG AASLMALVRD GGLDPFNGSL YVFRSKRADR VRIVWWDGSG        60
     VCLYSKTLEE QGFCWPGISA ARMRLDHPQL MALLAGLDWK KIRPAKIRRP LLTG             114
//

If you have problems or comments...

PBIL Back to PBIL home page