(data stored in ACNUC7421 zone)

EMBL: CP001389.PE577

CP001389.PE577       Location/Qualifiers
FT   CDS             643160..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05880"
FT                   /product="putative transposase number 3 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24381"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI33"
FT                   /protein_id="ACP24381.1"
FT                   /translation="MCSIASMDLPVSDLPDDVDALKAMILAMAREQAANETRLAAAAAE
FT                   VERLKAVEESANERIANLTAILKVLQRTQHGKRSERLRLAVNDEQVSFAFEEVETGLAA
FT                   IQSELDRAAGDKPKRAPRPRKGFAAHLERIEEVIEPEIPADCAGLEKVLIGEDRSERLD
FT                   VVPPKFRVIVTRRPKYAFRGRDGVAQALAPAHLIESGLPTERLLAYIAVSKYADGLPLY
FT                   RQEAIYLRDGVEVSRSLMAQWMGHLGFELQMVADYILERVKEGERVFADETSLPTLAPG
FT                   SGKTTKAWLWAYARDDRPYGGTSPPMVAYRFEDSRGGDCVARHLAGFSGILQVDGYSAY
FT                   TSLAKTRAKTGSNEPIQLAGCWAHLRRKFYDLHISGVSQAATESIVAMTELWKLEDEVR
FT                   GKNAESRAARRHEESATIVASLFELWEKELGKVSGKSKTAEAIRYAFTRREALECFLTD
FT                   GRIEIDSNIVERAIRPQTITRKNSLFAGSEGGGRTWATVATLLQTAKMNSVDPLDWLSQ
FT                   TLTRIAQGWPASEIEALMPWNFKPDVIG"
     MCSIASMDLP VSDLPDDVDA LKAMILAMAR EQAANETRLA AAAAEVERLK AVEESANERI        60
     ANLTAILKVL QRTQHGKRSE RLRLAVNDEQ VSFAFEEVET GLAAIQSELD RAAGDKPKRA       120
     PRPRKGFAAH LERIEEVIEP EIPADCAGLE KVLIGEDRSE RLDVVPPKFR VIVTRRPKYA       180
     FRGRDGVAQA LAPAHLIESG LPTERLLAYI AVSKYADGLP LYRQEAIYLR DGVEVSRSLM       240
     AQWMGHLGFE LQMVADYILE RVKEGERVFA DETSLPTLAP GSGKTTKAWL WAYARDDRPY       300
     GGTSPPMVAY RFEDSRGGDC VARHLAGFSG ILQVDGYSAY TSLAKTRAKT GSNEPIQLAG       360
     CWAHLRRKFY DLHISGVSQA ATESIVAMTE LWKLEDEVRG KNAESRAARR HEESATIVAS       420
     LFELWEKELG KVSGKSKTAE AIRYAFTRRE ALECFLTDGR IEIDSNIVER AIRPQTITRK       480
     NSLFAGSEGG GRTWATVATL LQTAKMNSVD PLDWLSQTLT RIAQGWPASE IEALMPWNFK       540
     PDVIG                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page