(data stored in ACNUC7421 zone)

EMBL: CP001389.PE578

CP001389.PE578       Location/Qualifiers
FT   CDS             644960..645283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI34"
FT                   /protein_id="ACP24382.1"
FT                   /translation="MFPGTHRFQGCANGFVIDFYAWDRNCLQSPSLEMVEEFGFVLQPT
FT                   FLEDLQQGIPSSGFGQRALGDLEIKIRQMAAVEMANQIMRAEDDLSADSLHVSTVSGIM
FT                   RAV"
     MFPGTHRFQG CANGFVIDFY AWDRNCLQSP SLEMVEEFGF VLQPTFLEDL QQGIPSSGFG        60
     QRALGDLEIK IRQMAAVEMA NQIMRAEDDL SADSLHVSTV SGIMRAV                     107
//

If you have problems or comments...

PBIL Back to PBIL home page