(data stored in ACNUC7421 zone)

EMBL: CP001389.PE579

CP001389.PE579       Location/Qualifiers
FT   CDS             645574..645840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24383"
FT                   /db_xref="GOA:C3MI35"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI35"
FT                   /protein_id="ACP24383.1"
FT                   /translation="MPVEALVLHGVSRQHAVPSAGKDGFIARLDQIRDKSAVALSRKGA
FT                   VFTRPALVAEVEYSAWTEDGKLRHPSIKGLRERADDTIVFEIA"
     MPVEALVLHG VSRQHAVPSA GKDGFIARLD QIRDKSAVAL SRKGAVFTRP ALVAEVEYSA        60
     WTEDGKLRHP SIKGLRERAD DTIVFEIA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page