(data stored in ACNUC7421 zone)

EMBL: CP001389.PE580

CP001389.PE580       Location/Qualifiers
FT   CDS             complement(645933..647006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24384"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI36"
FT                   /protein_id="ACP24384.1"
FT                   /translation="MPQLWYKCATSQTDCILAVMATDSHDLSTESELLTSLPDIAVSVQ
FT                   GFGSQDTAQALGNGVIHLLHEVGRFIDISSLDGVTIAVDYDAALRDLDRGIEGLRPEER
FT                   TKDGILTGVGKAILVKRADDVKTHLVFAAEALSCLALKEADSGLFYLALALIAHECAHV
FT                   EEHARRNRQFPGTLLNEESLGFVPACLRQFSEAFWCEYAVCRASANFAPNEGDGFREAL
FT                   KLRLEPARREAREAIKAYRTHGDALRVFNEVGLAVIEPLRMASYLFGHLDGFSGDLTDV
FT                   TIELPTNDQAFVAGITELVSQLRDLWDRRDHWESHDDMLVLGETAFDVLRLCGVDVQPS
FT                   ANGQAHIAVPITLDTIP"
     MPQLWYKCAT SQTDCILAVM ATDSHDLSTE SELLTSLPDI AVSVQGFGSQ DTAQALGNGV        60
     IHLLHEVGRF IDISSLDGVT IAVDYDAALR DLDRGIEGLR PEERTKDGIL TGVGKAILVK       120
     RADDVKTHLV FAAEALSCLA LKEADSGLFY LALALIAHEC AHVEEHARRN RQFPGTLLNE       180
     ESLGFVPACL RQFSEAFWCE YAVCRASANF APNEGDGFRE ALKLRLEPAR REAREAIKAY       240
     RTHGDALRVF NEVGLAVIEP LRMASYLFGH LDGFSGDLTD VTIELPTNDQ AFVAGITELV       300
     SQLRDLWDRR DHWESHDDML VLGETAFDVL RLCGVDVQPS ANGQAHIAVP ITLDTIP          357
//

If you have problems or comments...

PBIL Back to PBIL home page