(data stored in ACNUC7421 zone)

EMBL: CP001389.PE581

CP001389.PE581       Location/Qualifiers
FT   CDS             647440..647865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24385"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI37"
FT                   /protein_id="ACP24385.1"
FT                   /translation="MFVLPLAGIVIGGAYGWATVPPEDTISASFPICASGARTTCVVDG
FT                   DTFWLDGIKYRISDIDTPEISEPKCAWERELGQRAKYRLQSLLNGGSFGLKAGLRDADK
FT                   YGRKLREVYRGGRSLGAQLIDEGLAHRWLGFKQSWCG"
     MFVLPLAGIV IGGAYGWATV PPEDTISASF PICASGARTT CVVDGDTFWL DGIKYRISDI        60
     DTPEISEPKC AWERELGQRA KYRLQSLLNG GSFGLKAGLR DADKYGRKLR EVYRGGRSLG       120
     AQLIDEGLAH RWLGFKQSWC G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page