(data stored in ACNUC7421 zone)

EMBL: CP001389.PE584

CP001389.PE584       Location/Qualifiers
FT   CDS             complement(652137..652898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05950"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24388"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI40"
FT                   /protein_id="ACP24388.1"
FT                   /translation="MKMHFLAGGRLRMRRSVFVPGVGKEETIELPVHATLIRHRQGNVL
FT                   FDTGCNPEAATDPEARWGGLAKVMTPIFDPEQTVVRQLAALGLEAGDIDVVICSHLHPD
FT                   HCGCNQYFGRATILCHEAEVAAAKTDAAENQGYLKPEWDQPQGFQTFGAEHDVFGDGHI
FT                   VLLPMPGHTPGMTVAHVSLRDSGTFVLASDAAPLQANIDAGVAPRNTWNMELAAAALAR
FT                   LKAFRDKGATIVSGHDEAQWQALRKGGEFYE"
     MKMHFLAGGR LRMRRSVFVP GVGKEETIEL PVHATLIRHR QGNVLFDTGC NPEAATDPEA        60
     RWGGLAKVMT PIFDPEQTVV RQLAALGLEA GDIDVVICSH LHPDHCGCNQ YFGRATILCH       120
     EAEVAAAKTD AAENQGYLKP EWDQPQGFQT FGAEHDVFGD GHIVLLPMPG HTPGMTVAHV       180
     SLRDSGTFVL ASDAAPLQAN IDAGVAPRNT WNMELAAAAL ARLKAFRDKG ATIVSGHDEA       240
     QWQALRKGGE FYE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page