(data stored in ACNUC7421 zone)

EMBL: CP001389.PE585

CP001389.PE585       Location/Qualifiers
FT   CDS             complement(652895..653380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05960"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="COdehydrogenase subunit S; CO-DH S"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24389"
FT                   /db_xref="GOA:C3MI41"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI41"
FT                   /protein_id="ACP24389.1"
FT                   /translation="MPEKKITLSVSVNGVAHTATVEPRMLLSDFLRHELGLTGTHVGCE
FT                   HGVCGACTVILDGRSARSCLTLAVQAEGVEIETVEGQGSVDRLGRIQEAFRQHHALQCG
FT                   FCTPGFIMAITDMLRHHPLESDEQIREALSGNICRCTGYEHIVNAVRELARERGPLT"
     MPEKKITLSV SVNGVAHTAT VEPRMLLSDF LRHELGLTGT HVGCEHGVCG ACTVILDGRS        60
     ARSCLTLAVQ AEGVEIETVE GQGSVDRLGR IQEAFRQHHA LQCGFCTPGF IMAITDMLRH       120
     HPLESDEQIR EALSGNICRC TGYEHIVNAV RELARERGPL T                           161
//

If you have problems or comments...

PBIL Back to PBIL home page