(data stored in ACNUC7421 zone)

EMBL: CP001389.PE586

CP001389.PE586       Location/Qualifiers
FT   CDS             complement(653373..654434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05970"
FT                   /product="carbon monoxide dehydrogenase medium chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="COdehydrogenase subunit M; CO-DH M"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24390"
FT                   /db_xref="GOA:C3MI42"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI42"
FT                   /protein_id="ACP24390.1"
FT                   /translation="MLDNPILSLIMQVNFETRHGIGETRRSRDDKAFRDISEPSGAHGP
FT                   TMPESAFPIDGGEMKPAPFEYLAATSAAEAAEALAAANGDGKIIAGGQSLMPMINFRLV
FT                   KPTILIDINRIAGLDRIEKHGERLRIGATVRHRMTATDALVHRHIPILHDAMHHVAHLT
FT                   VRNRGTFCGSVCHADPAAEMPVMTLLLDGTITALSIRGERQIAASDFFVGSLMTALEPD
FT                   EFVTSIDIDTLPPETGWGFEEFSRRHGDFALACVATTLRIVDGVAGDVRFGMMGVGETP
FT                   LRLPDIETLVEGQAISEMLLQDVSETLKGLLHPNTDIHASADYRLHLAGALARRALRDA
FT                   WTRATLRKDGADA"
     MLDNPILSLI MQVNFETRHG IGETRRSRDD KAFRDISEPS GAHGPTMPES AFPIDGGEMK        60
     PAPFEYLAAT SAAEAAEALA AANGDGKIIA GGQSLMPMIN FRLVKPTILI DINRIAGLDR       120
     IEKHGERLRI GATVRHRMTA TDALVHRHIP ILHDAMHHVA HLTVRNRGTF CGSVCHADPA       180
     AEMPVMTLLL DGTITALSIR GERQIAASDF FVGSLMTALE PDEFVTSIDI DTLPPETGWG       240
     FEEFSRRHGD FALACVATTL RIVDGVAGDV RFGMMGVGET PLRLPDIETL VEGQAISEML       300
     LQDVSETLKG LLHPNTDIHA SADYRLHLAG ALARRALRDA WTRATLRKDG ADA              353
//

If you have problems or comments...

PBIL Back to PBIL home page