(data stored in ACNUC7421 zone)

EMBL: CP001389.PE587

CP001389.PE587       Location/Qualifiers
FT   CDS             654489..655295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05980"
FT                   /product="conserved hypothetical protein with CoxG domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24391"
FT                   /db_xref="GOA:C3MI43"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI43"
FT                   /protein_id="ACP24391.1"
FT                   /translation="MDMTGQQHIPASKEEVWSALNDADVLKVCIPGCQELTKSSETEMS
FT                   AVAVIKVGPVKARFQGAVTLSDLDPPNGYRITGEGQGGVAGFAKGVAVVRLEAVEDGTV
FT                   LHYTVDAQIGGKLSQLGGRLIDATAKQMSGQFFKRFAEEIRARQGAGQSLATSTEGDAF
FT                   AQPGPVRQSVAVTSSSESASALPRARAVQVSASPTGTSLSLPVLAAVVFAAVVVATWAL
FT                   HGGLLPSLTPPADGPARISPDLASIVQLIMAAAIGYLFGSRGRRAG"
     MDMTGQQHIP ASKEEVWSAL NDADVLKVCI PGCQELTKSS ETEMSAVAVI KVGPVKARFQ        60
     GAVTLSDLDP PNGYRITGEG QGGVAGFAKG VAVVRLEAVE DGTVLHYTVD AQIGGKLSQL       120
     GGRLIDATAK QMSGQFFKRF AEEIRARQGA GQSLATSTEG DAFAQPGPVR QSVAVTSSSE       180
     SASALPRARA VQVSASPTGT SLSLPVLAAV VFAAVVVATW ALHGGLLPSL TPPADGPARI       240
     SPDLASIVQL IMAAAIGYLF GSRGRRAG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page