(data stored in ACNUC7421 zone)

EMBL: CP001389.PE589

CP001389.PE589       Location/Qualifiers
FT   CDS             complement(656337..657224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06000"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24393"
FT                   /db_xref="GOA:C3MI45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI45"
FT                   /protein_id="ACP24393.1"
FT                   /translation="MTDIFGVPIAVLLGQLLLGLINGSFYALLSLGLAIIFGMLNVINF
FT                   AHGAFYMLGGFAAWLLLSALGLGYWETLIAAPLMVGALGAVVERLFLKRLYRVDHLYSL
FT                   LLTFGIALMLEGLLRHVYGAAGKPYPIPPSLTGGINLGFMFLPMYRAWVIVASLAVCIA
FT                   TWLAIERTKLGAYLRAATENPGLVQAFGINVPFMLTATYAFCVGLAGFAGALAAPLYQV
FT                   SPGMGSSVIIVVFAVVVIGGMGSIGGAIVTALALGIIEGLTKTFYPAASSIAVFVVMVL
FT                   VILIRPSGLFSREA"
     MTDIFGVPIA VLLGQLLLGL INGSFYALLS LGLAIIFGML NVINFAHGAF YMLGGFAAWL        60
     LLSALGLGYW ETLIAAPLMV GALGAVVERL FLKRLYRVDH LYSLLLTFGI ALMLEGLLRH       120
     VYGAAGKPYP IPPSLTGGIN LGFMFLPMYR AWVIVASLAV CIATWLAIER TKLGAYLRAA       180
     TENPGLVQAF GINVPFMLTA TYAFCVGLAG FAGALAAPLY QVSPGMGSSV IIVVFAVVVI       240
     GGMGSIGGAI VTALALGIIE GLTKTFYPAA SSIAVFVVMV LVILIRPSGL FSREA            295
//

If you have problems or comments...

PBIL Back to PBIL home page