(data stored in ACNUC7421 zone)

EMBL: CP001389.PE591

CP001389.PE591       Location/Qualifiers
FT   CDS             complement(657960..658718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06020"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24395"
FT                   /db_xref="GOA:C3MI47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI47"
FT                   /protein_id="ACP24395.1"
FT                   /translation="MPDSAPIIEARALTRSFSGFIAVKNVDLKIRAGTIHALIGPNGAG
FT                   KSTLFNLLTKFLSPSSGQILFKDRDITQMAPADIARLGLVRSFQISSVFPHLSAHENVR
FT                   VALQAHAKETFAFWKSNATLRRFNEEAARLLDSVGLADRAQTKAAELSYGRKRALELAT
FT                   TLALDPEVLLLDEPMAGMGTEDIGRTAALIRSVGKGRTVLMVEHNLGVVSDLSDRITVL
FT                   RRGEVIAEGSYADVSADSEVRKAYMGGSHG"
     MPDSAPIIEA RALTRSFSGF IAVKNVDLKI RAGTIHALIG PNGAGKSTLF NLLTKFLSPS        60
     SGQILFKDRD ITQMAPADIA RLGLVRSFQI SSVFPHLSAH ENVRVALQAH AKETFAFWKS       120
     NATLRRFNEE AARLLDSVGL ADRAQTKAAE LSYGRKRALE LATTLALDPE VLLLDEPMAG       180
     MGTEDIGRTA ALIRSVGKGR TVLMVEHNLG VVSDLSDRIT VLRRGEVIAE GSYADVSADS       240
     EVRKAYMGGS HG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page