(data stored in ACNUC7421 zone)

EMBL: CP001389.PE592

CP001389.PE592       Location/Qualifiers
FT   CDS             658980..660188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06030"
FT                   /product="putative ABC branched-chain amino transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24396"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI48"
FT                   /protein_id="ACP24396.1"
FT                   /translation="MKNKLMLLSCVAAVGAMTMSAGAQDAAPVRIGVLTDVSGQFSHEA
FT                   GEGSITAVKMAVEDFGGKVLDRPLEVVVADHQNKPEVAVSTAREWYESQGVTMINNLIN
FT                   SGIALAVTQVAKDEDRIAIVNGSGSSRLTNDGCTPNSIHYSYDTYALANGTANQLILQG
FT                   MKNWFFLTADYAFGHALEADATQIVKDNDGEVSGSVRYPIETSDHSAFMLQAQASPAQV
FT                   VAMAGSGTTFINAVKSAAEFGLAASGKTVAGLLVWDTDVHSLGLETAQGMILTNAFYWD
FT                   RDDATRAFSKRFEERVGRPPHMGDAGDYSSTMHYLKAVEAAGTTDAQKVMAKMRETPIN
FT                   DFFAKNGKIREDGRMVHDMYVYQVKTPAESTGEWDILKLVTTISGDDAFRPLSESQCPL
FT                   VKN"
     MKNKLMLLSC VAAVGAMTMS AGAQDAAPVR IGVLTDVSGQ FSHEAGEGSI TAVKMAVEDF        60
     GGKVLDRPLE VVVADHQNKP EVAVSTAREW YESQGVTMIN NLINSGIALA VTQVAKDEDR       120
     IAIVNGSGSS RLTNDGCTPN SIHYSYDTYA LANGTANQLI LQGMKNWFFL TADYAFGHAL       180
     EADATQIVKD NDGEVSGSVR YPIETSDHSA FMLQAQASPA QVVAMAGSGT TFINAVKSAA       240
     EFGLAASGKT VAGLLVWDTD VHSLGLETAQ GMILTNAFYW DRDDATRAFS KRFEERVGRP       300
     PHMGDAGDYS STMHYLKAVE AAGTTDAQKV MAKMRETPIN DFFAKNGKIR EDGRMVHDMY       360
     VYQVKTPAES TGEWDILKLV TTISGDDAFR PLSESQCPLV KN                          402
//

If you have problems or comments...

PBIL Back to PBIL home page