(data stored in ACNUC7421 zone)

EMBL: CP001389.PE598

CP001389.PE598       Location/Qualifiers
FT   CDS             665074..665214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24402"
FT                   /db_xref="GOA:C3MI54"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI54"
FT                   /protein_id="ACP24402.1"
FT                   /translation="MTMPSEGLISTEVAPFGGMKESGNGREGSKYGMDDYLEIKYMCMG
FT                   I"
     MTMPSEGLIS TEVAPFGGMK ESGNGREGSK YGMDDYLEIK YMCMGI                       46
//

If you have problems or comments...

PBIL Back to PBIL home page